SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 579112.VCM66_0931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579112.VCM66_0931
Domain Number 1 Region: 133-188
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000105
Family NfeD domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  579112.VCM66_0931
Domain Number - Region: 68-122
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00379
Family LacY-like proton/sugar symporter 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 579112.VCM66_0931
Sequence length 189
Comment (Vibrio cholerae M66 2)
Sequence
MVKQRMVRSSCCHLKQQASWVLSLELQKCLNHHKPLSRCPVVELLSQLNFWHWLALGLLL
LAAELLGTAGYFLWLGLSALLVGVLLAVMPLGWQLQWLAFASFSLVTTWLWWRRQFSRDK
KQDTERDLNQKEKQLLGRIIPITQDTPAGEFQVTLGDTAWTARCDQQLAAGSRVSVVAVD
GIILVVQPI
Download sequence
Identical sequences C3LTM3 D7H7I0 Q9KTC7
243277.VC0975 579112.VCM66_0931 GO.3506 gi|227081149|ref|YP_002809700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]