SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 579137.Metvu_0125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579137.Metvu_0125
Domain Number 1 Region: 74-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000915
Family NfeD domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 579137.Metvu_0125
Sequence length 138
Comment (Methanocaldococcus vulcanius M7)
Sequence
MEIGYVFILSGFLIIALEVVIPGLYFPAWGIALVVYGVFLLLFPQYAFVSAIVAGFLTVI
CLYKFVYSSGKDIKVGAERFIGMIGRAIEDFKENGYGRIEVENQVWQAKSKDKIKRGDKV
KIVGVEGVSLIVQKVSEG
Download sequence
Identical sequences C9REJ1
WP_012819539.1.10243 579137.Metvu_0125 gi|261402251|ref|YP_003246475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]