SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 579137.Metvu_1066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579137.Metvu_1066
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000217
Family CAP C-terminal domain-like 0.079
Further Details:      
 
Weak hits

Sequence:  579137.Metvu_1066
Domain Number - Region: 91-118
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0562
Family NfeD domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 579137.Metvu_1066
Sequence length 269
Comment (Methanocaldococcus vulcanius M7)
Sequence
MKKRNITEFQVLSEIIRKQPHIKQKEIAENLGVTVQAVSEHIRNLVKEGYVKSRGRGEYV
VTEKGLRKLKNWISEFRDYLDEINTAVYRYKDIWPAIANEDIEDGEIVYLFMRRGLLYAS
KEPKGKAKAKVLYGGKKGEDISICEIKGIIDVPKGKVIVFRIPPEVVGGSRAVNYDLIKE
SMDELDNYVIATMGTVAYVVASKLNVEPEIRFAVPEAIVNACNRGCNVIALITGKMAEKV
IKKLDNSRISYTVLDATKEKEKRQNIKIK
Download sequence
Identical sequences C9RH72
579137.Metvu_1066 gi|261403182|ref|YP_003247406.1| WP_015733144.1.10243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]