SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 579137.Metvu_1157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579137.Metvu_1157
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.42e-56
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 579137.Metvu_1157
Sequence length 179
Comment (Methanocaldococcus vulcanius M7)
Sequence
MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RCQIYEPDYVIVQDPTLLESVNVVDGLKENGAVIINTVKEDLDLGYKTYTIDATGIALDV
LGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTFKGKLGEKNAKAAELAYNEMIKKYGK
Download sequence
Identical sequences C9RHG3
579137.Metvu_1157 gi|261403273|ref|YP_003247497.1| WP_015733235.1.10243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]