SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 579137.Metvu_1238 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579137.Metvu_1238
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 579137.Metvu_1238
Sequence length 180
Comment (Methanocaldococcus vulcanius M7)
Sequence
MRKEIRLSGFGGQGIILAGVILGRAAALYDKKEAVQTQSYGPEARGGASKSEVVISEEPI
DFPKVIKPDILVCLSQQAYDKYKDDIKDGGILLIDEDLVSIEQKPKADVKIYKIPFTRIA
SEDIKLPIVANIVMLGSLTKLTGIVSEESMKKSILDSVPKGTEEKNLLAFNKGYEFAENL
Download sequence
Identical sequences C9RHP2
579137.Metvu_1238 gi|261403352|ref|YP_003247576.1| WP_015733314.1.10243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]