SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 579405.Dd703_1033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  579405.Dd703_1033
Domain Number 1 Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000157
Family NfeD domain-like 0.0051
Further Details:      
 
Weak hits

Sequence:  579405.Dd703_1033
Domain Number - Region: 28-83
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00994
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 579405.Dd703_1033
Sequence length 149
Comment (Dickeya dadantii Ech703)
Sequence
MIELLQGNSHWFWLSLGGLLLAAEMLGASGYLLWSGLSAMLTGVLTWLLPLDWAWQSVSF
ALLTIITALLWWHWLRQRSRKEPISTLNQRGRQLLGRHATLTEPLVNGIGRIDIGDSSWR
VQAERDLPAGTVVEIVDVEGITLKVKPNA
Download sequence
Identical sequences C6CBQ3
579405.Dd703_1033 gi|242238479|ref|YP_002986660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]