SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 582402.Hbal_1037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  582402.Hbal_1037
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000068
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 582402.Hbal_1037
Sequence length 154
Comment (Hirschia baltica ATCC 49814)
Sequence
MDALFTELTVWHWIALAIGLLIFEMMLGTFDLLWIAIAAGITALYASLAPGSLSSWEYEV
GVFVISSIILMVLGRTMFAGIRNPPTSHPNLNDRYASMIGKKAIVTGEFLGGFGRVKVND
SEWRAQFNEEGVLNIGDNVEIVSGEGSTVIVKPA
Download sequence
Identical sequences C6XR99
WP_015826881.1.52863 582402.Hbal_1037 gi|254293405|ref|YP_003059428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]