SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 582744.Msip34_0091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  582744.Msip34_0091
Domain Number 1 Region: 81-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000222
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 582744.Msip34_0091
Sequence length 150
Comment (Methylovorus SIP3 4)
Sequence
MDAVWIWGIFGLVLLSAELATGTLYILWFGLAALIISGLLWLFPAISLGVQLLLFAGLSL
STLLIWKKFERRQPAASRLGQSQGEEIGRTGQIVVAVSPEQCGRIRFSQGVMGSKEWTAI
SSQTLAVGEEAEITSIEGNALRVKRSGVAA
Download sequence
Identical sequences C6X870
582744.Msip34_0091 WP_013440916.1.53399 WP_013440916.1.76919 gi|253997804|ref|YP_003049867.1| gi|313199868|ref|YP_004038526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]