SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 582744.Msip34_2242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  582744.Msip34_2242
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily GlnB-like 8.9e-26
Family Prokaryotic signal transducing protein 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 582744.Msip34_2242
Sequence length 111
Comment (Methylovorus SIP3 4)
Sequence
MKEIKAVVQPNRLPKIRSALRNIKGFPGMTVSKVDGCGHFVAKPSGGIREELTDYSPKVR
IELVTPDELVEGVLQVLVEVGHTGQVGDGIVWVTPVERMIRLSEQITVLEC
Download sequence
Identical sequences C6X9U3
WP_015830799.1.76919 gi|253999948|ref|YP_003052011.1| 582744.Msip34_2242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]