SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 585054.EFER_0546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  585054.EFER_0546
Domain Number 1 Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000392
Family NfeD domain-like 0.0076
Further Details:      
 
Weak hits

Sequence:  585054.EFER_0546
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000432
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 585054.EFER_0546
Sequence length 152
Comment (Escherichia fergusonii ATCC 35469)
Sequence
MIEMIAIHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPLGWEWQGVMF
AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLAAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences B7LJG2
585054.EFER_0546 WP_000571816.1.80724 gi|218547943|ref|YP_002381734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]