SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 585056.ECUMN_0276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  585056.ECUMN_0276
Domain Number - Region: 127-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0706
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 585056.ECUMN_0276
Sequence length 221
Comment (Escherichia coli UMN026)
Sequence
MKNYLWLVALLPLLSGCESQAILVKKDDAYFAPPKTEAPPPADGRAGGVFETGYNWSLTA
DRRAYRVGDILTVILEESTQSSKQAKTNFGKNNTVDIGAPTIFGHTKDKLSGSIDANRDF
DGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLNQGDEYIRLSGLVRADDIQND
NSVSSQRIADARISYAGRGALSDANAAGWLTRLFNHPLFPI
Download sequence
Identical sequences A0A073HTZ0 A0A073UV43 A0A0G3K3K5 B7N8E1 D3GSA6 Q5DY12 T9BCM6 U9Z116
WP_000800864.1.100194 WP_000800864.1.10100 WP_000800864.1.12574 WP_000800864.1.12697 WP_000800864.1.13295 WP_000800864.1.14042 WP_000800864.1.14687 WP_000800864.1.15090 WP_000800864.1.15951 WP_000800864.1.16322 WP_000800864.1.16685 WP_000800864.1.16979 WP_000800864.1.17568 WP_000800864.1.1772 WP_000800864.1.1861 WP_000800864.1.18843 WP_000800864.1.19276 WP_000800864.1.1952 WP_000800864.1.2075 WP_000800864.1.21255 WP_000800864.1.2198 WP_000800864.1.22814 WP_000800864.1.23752 WP_000800864.1.2413 WP_000800864.1.24926 WP_000800864.1.25890 WP_000800864.1.26262 WP_000800864.1.26419 WP_000800864.1.26839 WP_000800864.1.27396 WP_000800864.1.28102 WP_000800864.1.28639 WP_000800864.1.31433 WP_000800864.1.31542 WP_000800864.1.31809 WP_000800864.1.33101 WP_000800864.1.33369 WP_000800864.1.34144 WP_000800864.1.34204 WP_000800864.1.34348 WP_000800864.1.3439 WP_000800864.1.34441 WP_000800864.1.34558 WP_000800864.1.34675 WP_000800864.1.34838 WP_000800864.1.35132 WP_000800864.1.35168 WP_000800864.1.36105 WP_000800864.1.3668 WP_000800864.1.37290 WP_000800864.1.39733 WP_000800864.1.4005 WP_000800864.1.40893 WP_000800864.1.41956 WP_000800864.1.42443 WP_000800864.1.43123 WP_000800864.1.436 WP_000800864.1.4454 WP_000800864.1.4471 WP_000800864.1.45740 WP_000800864.1.46531 WP_000800864.1.46594 WP_000800864.1.47073 WP_000800864.1.48689 WP_000800864.1.51360 WP_000800864.1.52257 WP_000800864.1.53589 WP_000800864.1.53991 WP_000800864.1.54411 WP_000800864.1.54601 WP_000800864.1.54927 WP_000800864.1.56293 WP_000800864.1.56502 WP_000800864.1.57182 WP_000800864.1.57266 WP_000800864.1.57438 WP_000800864.1.57983 WP_000800864.1.57994 WP_000800864.1.58098 WP_000800864.1.58799 WP_000800864.1.58999 WP_000800864.1.59748 WP_000800864.1.59788 WP_000800864.1.60048 WP_000800864.1.6068 WP_000800864.1.61006 WP_000800864.1.61046 WP_000800864.1.61132 WP_000800864.1.61284 WP_000800864.1.61364 WP_000800864.1.6138 WP_000800864.1.62631 WP_000800864.1.6307 WP_000800864.1.63608 WP_000800864.1.64695 WP_000800864.1.64901 WP_000800864.1.64990 WP_000800864.1.65408 WP_000800864.1.65976 WP_000800864.1.66448 WP_000800864.1.66794 WP_000800864.1.67035 WP_000800864.1.67992 WP_000800864.1.68200 WP_000800864.1.68924 WP_000800864.1.69160 WP_000800864.1.70041 WP_000800864.1.70597 WP_000800864.1.71421 WP_000800864.1.71939 WP_000800864.1.72161 WP_000800864.1.72248 WP_000800864.1.73283 WP_000800864.1.74045 WP_000800864.1.75218 WP_000800864.1.75306 WP_000800864.1.75725 WP_000800864.1.76305 WP_000800864.1.77296 WP_000800864.1.77577 WP_000800864.1.77632 WP_000800864.1.78477 WP_000800864.1.79126 WP_000800864.1.79233 WP_000800864.1.79759 WP_000800864.1.79995 WP_000800864.1.80718 WP_000800864.1.80935 WP_000800864.1.81423 WP_000800864.1.81843 WP_000800864.1.82698 WP_000800864.1.82808 WP_000800864.1.83660 WP_000800864.1.84319 WP_000800864.1.84731 WP_000800864.1.85241 WP_000800864.1.85361 WP_000800864.1.86788 WP_000800864.1.8679 WP_000800864.1.87635 WP_000800864.1.88941 WP_000800864.1.89466 WP_000800864.1.89583 WP_000800864.1.90022 WP_000800864.1.91007 WP_000800864.1.91220 WP_000800864.1.91361 WP_000800864.1.91543 WP_000800864.1.91549 WP_000800864.1.91666 WP_000800864.1.92114 WP_000800864.1.92215 WP_000800864.1.92886 WP_000800864.1.93167 WP_000800864.1.9331 WP_000800864.1.9356 WP_000800864.1.93716 WP_000800864.1.94754 WP_000800864.1.94823 WP_000800864.1.94841 WP_000800864.1.94927 WP_000800864.1.94934 WP_000800864.1.96609 WP_000800864.1.96820 WP_000800864.1.97890 WP_000800864.1.97919 WP_000800864.1.98167 WP_000800864.1.98466 WP_000800864.1.99366 YP_002411047.1.14968 585056.ECUMN_0276 gi|218703528|ref|YP_002411047.1| gi|387605747|ref|YP_006094603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]