SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 585057.ECIAI39_0465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  585057.ECIAI39_0465
Domain Number 1 Region: 93-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000719
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  585057.ECIAI39_0465
Domain Number - Region: 31-79
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00562
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 585057.ECIAI39_0465
Sequence length 151
Comment (Escherichia coli IAI39)
Sequence
MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMFA
ILTLLAAWLWWKWLARGVRGQKHSDSNLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSW
PVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A0H3MER5
585057.ECIAI39_0465 gi|218698868|ref|YP_002406497.1| YP_002406497.1.10275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]