SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5875.TP02_0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5875.TP02_0957
Domain Number - Region: 28-67
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0111
Family Nip7p homolog, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5875.TP02_0957
Sequence length 77
Comment (Theileria parva)
Sequence
MTTEDYEESSPETSISKYVFKSKLEQFYCDDEVIYTRKPEGKYCKCLTYNNINEFGEFFR
VFTKEGERYKILFTRKR
Download sequence
Identical sequences Q4N3N2
526.m03932 XP_765524.1.6148 5875.TP02_0957 gi|71031764|ref|XP_765524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]