SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 590409.Dd586_1075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  590409.Dd586_1075
Domain Number - Region: 106-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00012
Family NfeD domain-like 0.0081
Further Details:      
 
Domain Number - Region: 15-83
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.000183
Family Cation efflux protein transmembrane domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 590409.Dd586_1075
Sequence length 149
Comment (Dickeya dadantii Ech586)
Sequence
MMAQVLENAHWFWLSLGGLLLAAEMLGAGGYLLWSGVAALLTGILAWLLPLDWAWQGIAF
AVLTVIAALWWWQWLRRRLEKQPAPVLNQRGQQLIGLHTTLSEPLVNGFGRVNIGDSSWR
IQAEQDLPAGTVVEVTAVEGITLQVKPRA
Download sequence
Identical sequences D2BUM8
gi|271499639|ref|YP_003332664.1| 590409.Dd586_1075 WP_012883799.1.97449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]