SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001007129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001007129
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-31
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Weak hits

Sequence:  5911.XP_001007129
Domain Number - Region: 258-305
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000131
Family Mitotic arrest deficient-like 1, Mad1 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001007129
Sequence length 331
Comment (Tetrahymena thermophila)
Sequence
MKENDIPNNITSNIDKMIKELKQYGFDDFKFLGKGQQGNVLLAKEQKTNRRYAIKGFLIK
HDNGEIIEDHLKSANKEIEMLQQCKGSPFVVNIFRQIDGQYFKYLILNECQGSLNQILDK
QSNKLLNEITAIKYSKDIAEGLLHIHSKKCVANDLKMDNILIDYNGNAKGNYQYCAPECC
LDSEIYEYPKEYQKQQILIETNPTPKTMVDDDQGVTQQYIRQIKKDIEFIQCSENTFYPI
IFNSQNEKEFVQALDSYVPMLQKQIKDLTKKTEELQNQNLILEEKKNQLQKKLDQLTLQN
DTMQQYCQKLGCIVSKNNFIQSKLFKNQNYF
Download sequence
Identical sequences 17.m00423 5911.XP_001007129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]