SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001019198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001019198
Domain Number 1 Region: 614-805
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-42
Family cAMP-binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 496-648
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-26
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Weak hits

Sequence:  5911.XP_001019198
Domain Number - Region: 813-831
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0392
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001019198
Sequence length 1254
Comment (Tetrahymena thermophila)
Sequence
MSQQKIIKFDKKYNFQFLIKIKIKQKYPLIFILFILIIDKVNQRNLLQMSQSEYPQNLEG
LNKIMYLYQINQEANQYLHLQQFDINLPKQILNTSSTNNQMDYQSQENEENYVSVRDFTE
INSTSQSVNKSQLENLLFKTERHKQCGLQPLNSTILPKINLCEKQQENASKESIIRQPNR
NLSKQIRKTSYVQIRPTKTSIGANLEPKEREGSIQDSFLCNQNTINKAINQRRRSSRMQV
EQFQNTLLKMIQDKTSNQQEQKQKMLDIPDQNETLQTQEQEKSQIQNQVGEEQSCKLDTI
QKLKKKDDKLKNSFVSRLGIFQRFIRNIKNLSQSYKFRIMKAEQKLRFNDLSFYQQKNKE
MGNQSFSQKILFRIFSKVFQKLANQIPVFEPLHLWVICLELIVLITLTAQLFTLPLADSF
DVNYLKQGGCKVVFYYIPAIALIISIFSKLNTGFFKENIAVHDRKKIFLNYYYSGELMID
LITVLSFFATQDIYDYVFLLLKIYQIQNSIVKLIFIVMILAHLNGCIFHQVAKNVDESWI
TKNNLKTANWYEQYINSVYFSFITMVTVGYGDITPVSLQEKVFVIFMVVYSCGFFGYIVS
SIGNIFTQRAQIQANYKRQLVDMIQYMKTRNISQVIQQQVFQYLHYLEQMDYYNHQKGEE
IVKKLSPYLQQQININSYYPFLKSSNYFKLNFKDTILINASLKMKELTFGPGQIIFKQND
QDNRLFYILKGEVQLSSNNHQICIKDENDNCFGINEFFTGECRNLEAKSLTVSQILYLEL
NEFKQVLKEDPLEYEKFCSLKDQVIFSKISIDQPCFFCNKFSHRYDQCPFYTLKNQRLLV
IEKSNRSISQERKQFERYDRFKFNSVLENAEVKLNLRAIRLNYINNLAIDKNEMIQLAQD
TIQIENDVDFYRYNDAFQLKQNSEGQDFNIILVSSDKIADEFFLEEEKLEYGEEGNDQLN
PIINSQKKVATSQTIATESLIEENKNQLQPALQNSQNQHRKSISFLQNAFHTQNSSNLNT
YNYEKLQTIKEQFSTTNHRIQNHTRQQSSRKNSDISISSYQNKNAEPSPSKVQEQNLLKQ
ILNLIELTQIKQEVENKHEVSFFIQKDEFFCINDFDQLQEFTRYFPKSNFSQVLGQISKT
NLKKQKVPLKKAKKNQNKPRNTVFKNLAIKKKNILSKINTCRALANKHKKSQDTPLVIAK
SSSYNQSNTESLSNALSCRTQEMQDFNIDQKSENKLLQSQQFDNVRSNFLKPQQ
Download sequence
Identical sequences 5911.XP_001019198 188.m00059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]