SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 592205.HELPY_0783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  592205.HELPY_0783
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 592205.HELPY_0783
Sequence length 186
Comment (Helicobacter pylori B38)
Sequence
MEVQLRFTGVGGQGVLLAGEILAEAKIVSGGYGTKTSTYTSQVRGGPTKVDILLDKDEII
FPYAKEGEIDFMLSVAQISYNQFKSDIKKGGIVVIDPNLVTPTKEDEEKYQLYKIPIISI
AKDEVGNIITQSVVALAITVELTKCVEENIVLDTMLKKVPAKVAETNKKAFEIGKKHALE
ALKVRA
Download sequence
Identical sequences C7C029
gi|254779416|ref|YP_003057521.1| 592205.HELPY_0783 WP_000453682.1.98582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]