SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 593117.TGAM_0509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  593117.TGAM_0509
Domain Number 1 Region: 78-143
Classification Level Classification E-value
Superfamily NfeD domain-like 5.89e-20
Family NfeD domain-like 0.00017
Further Details:      
 
Weak hits

Sequence:  593117.TGAM_0509
Domain Number - Region: 12-63
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0288
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 593117.TGAM_0509
Sequence length 145
Comment (Thermococcus gammatolerans EJ3)
Sequence
MRAMSTALAVSLLILGLLIILLDMMVTAFITPIGVTFAVLGLLLGFGMNFTESFVISLIA
AVISYILIGRYIRRDVEDVGRKERKYTFDLVGKRGKVVKVAEDHYLVELEGDRWIAFSDD
ELQAGDVVEVKAVDGVKLIVKKAER
Download sequence
Identical sequences C5A449
593117.TGAM_0509 gi|240102566|ref|YP_002958875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]