SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 593117.TGAM_0782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  593117.TGAM_0782
Domain Number 1 Region: 67-128
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000562
Family NfeD domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 593117.TGAM_0782
Sequence length 136
Comment (Thermococcus gammatolerans EJ3)
Sequence
MAGGKGVSLLKLIALIADEIIVGVFLLVVLPALGMGVPVLVTGLVLGVLLVKDVLIAPYV
LGGGLEKRPKAGPESLVGRTAVVVDDLSPEGLVKLDGELWRARCFHGTARRGEKVRVVEV
DGTKLLVELPASEEPR
Download sequence
Identical sequences C5A4X2
WP_015858402.1.60195 gi|240102839|ref|YP_002959148.1| 593117.TGAM_0782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]