SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 593117.TGAM_1902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  593117.TGAM_1902
Domain Number 1 Region: 13-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-30
Family Clp protease, ClpP subunit 0.031
Further Details:      
 
Domain Number 2 Region: 377-442
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000000107
Family NfeD domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  593117.TGAM_1902
Domain Number - Region: 252-382
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0562
Family LacY-like proton/sugar symporter 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 593117.TGAM_1902
Sequence length 454
Comment (Thermococcus gammatolerans EJ3)
Sequence
MIMKTRTLSRSAFIILVLMLLPAVLASPNQKTVYVAKFEGVITSYSVDQFSRYIEIAEKN
NAEALIIEIDTPGGSGQAMQEIIQRIKESKVPVIIYVYPPGAIAASAGTYIALGSHLIAM
APSTSIGACEPIMGYASNGSIIKAPAKVRNFYVAYIKSLAEASGRNVTAAERFITEDLSL
TPEEALRAHVIEVIANDVPDLLKKANGMKTKIPVKGKGYVTLNFTNARIVSIEPSFKDEV
VRYISDPTIAYVLINIGILGLIFGFLTPGWHVPETVGAILLVLGIIGLGYFGYNAAGLVL
IILAVIFFIAEALTPTFGLFTVAGAITMILGGILLFGGGNEYLIQRSTFSTLRAVIIAIA
VMLALFFAFGVSAVIRDRKRKAQTGKEEMIGEVGRVVQELNPEGMVKIRGELWKAESKTG
ERIGVGEKVRVVEVRGLTLIVVPEGVSPDEKKEV
Download sequence
Identical sequences C5A1Y5
gi|240103959|ref|YP_002960268.1| WP_015859510.1.60195 593117.TGAM_1902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]