SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59374.Fisuc_1243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59374.Fisuc_1243
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59374.Fisuc_1243
Sequence length 157
Comment (Fibrobacter succinogenes S85)
Sequence
MSVMNVKFAGLGGTGVIKASDVMAELVFEQGYDVKKAEVHGMSQRGGSIASDVRFAKDEE
VQSPMIPCGEADYLVVFDETQVVVNEAYMKQGGVLLTPADIDVSKLENVKALNVAMLGKL
SKYFDFTVDQWMVALNKLFAEKFHEGNKKAFMLGREG
Download sequence
Identical sequences 59374.Fisuc_1243 WP_015731959.1.27150 WP_015731959.1.64106 WP_015731959.1.74657 gi|261415645|ref|YP_003249328.1| gi|261415645|ref|YP_003249328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]