SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59374.Fisuc_2977 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59374.Fisuc_2977
Domain Number 1 Region: 60-190
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-21
Family Ribonuclease H 0.0034
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000152
Family N-terminal domain of RNase HI 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59374.Fisuc_2977
Sequence length 195
Comment (Fibrobacter succinogenes S85)
Sequence
MPKQKFYAVKSENEKKIVTTWDECLKLTHGVKGVLFKSFGSREEAQAWLDGMEAPAPDGI
RVFVDGSFSPGFGPAGWAFVVTEDDNELARGSGITAFDAESRNIDGEVMASFQAMRWLDA
HDMKGVICHDYEGIARWAKGEWQAKSNIAKMYVAAAKPYLHRVQFEKVAAHTGVKWNELV
DKLAKEAIAKAKKCK
Download sequence
Identical sequences C9RPM5
gi|261417356|ref|YP_003251039.1| gi|261417356|ref|YP_003251039.1| 59374.Fisuc_2977 WP_014545081.1.27150 WP_014545081.1.74657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]