SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 595494.Tola_2548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  595494.Tola_2548
Domain Number 1 Region: 111-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000262
Family NfeD domain-like 0.0056
Further Details:      
 
Weak hits

Sequence:  595494.Tola_2548
Domain Number - Region: 15-101
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0222
Family Multidrug efflux transporter AcrB transmembrane domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 595494.Tola_2548
Sequence length 156
Comment (Tolumonas auensis DSM 9187)
Sequence
MHSWAWLSLSDWSYWHWLILGAVLLLLELFGTAGLLLWTGISALLTALMVFVFEPGLFAQ
WSLFAVFSIITTWFWFRLNKQDKPTTEVKALNQRTTRCIGAQTTLLEDVKLGKSRVRIED
TVWGVLSSETLPAGTAVKVVAAEGTTLIVKALPVHH
Download sequence
Identical sequences C4LAG7
595494.Tola_2548 gi|237809288|ref|YP_002893728.1| WP_015879591.1.45904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]