SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 595496.BWG_1206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  595496.BWG_1206
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-117
Family PFOR PP module 0.000000035
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000122
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.3e-71
Family PFOR Pyr module 0.000000107
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 595496.BWG_1206
Sequence length 1174
Comment (Escherichia coli BW2952)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISQIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQVEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEAPEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A1L6AZV4 P52647
gi|388477458|ref|YP_489646.1| gi|238900607|ref|YP_002926403.1| 316385.ECDH10B_1502 316407.ydbK 511145.b1378 595496.BWG_1206 gi|387621096|ref|YP_006128723.1| ASG-ydbK gi|387621096|ref|YP_006128723.1| NP_415896.1.90541 WP_000628244.1.101033 WP_000628244.1.10188 WP_000628244.1.1113 WP_000628244.1.12582 WP_000628244.1.13618 WP_000628244.1.13949 WP_000628244.1.14529 WP_000628244.1.17087 WP_000628244.1.18381 WP_000628244.1.21057 WP_000628244.1.22113 WP_000628244.1.22830 WP_000628244.1.23511 WP_000628244.1.2428 WP_000628244.1.27879 WP_000628244.1.27923 WP_000628244.1.28697 WP_000628244.1.31211 WP_000628244.1.32121 WP_000628244.1.32984 WP_000628244.1.33424 WP_000628244.1.34124 WP_000628244.1.37261 WP_000628244.1.37588 WP_000628244.1.38105 WP_000628244.1.38636 WP_000628244.1.39365 WP_000628244.1.40192 WP_000628244.1.40317 WP_000628244.1.40389 WP_000628244.1.40548 WP_000628244.1.43489 WP_000628244.1.44115 WP_000628244.1.44162 WP_000628244.1.44365 WP_000628244.1.45933 WP_000628244.1.46802 WP_000628244.1.47048 WP_000628244.1.47634 WP_000628244.1.48974 WP_000628244.1.49531 WP_000628244.1.50006 WP_000628244.1.50078 WP_000628244.1.51552 WP_000628244.1.52020 WP_000628244.1.52558 WP_000628244.1.52895 WP_000628244.1.53012 WP_000628244.1.53020 WP_000628244.1.53377 WP_000628244.1.55825 WP_000628244.1.5614 WP_000628244.1.57414 WP_000628244.1.58951 WP_000628244.1.59306 WP_000628244.1.6066 WP_000628244.1.60717 WP_000628244.1.63167 WP_000628244.1.65271 WP_000628244.1.67853 WP_000628244.1.68711 WP_000628244.1.68797 WP_000628244.1.69305 WP_000628244.1.69473 WP_000628244.1.69803 WP_000628244.1.71975 WP_000628244.1.72157 WP_000628244.1.72397 WP_000628244.1.73859 WP_000628244.1.79004 WP_000628244.1.86461 WP_000628244.1.86475 WP_000628244.1.87389 WP_000628244.1.88434 WP_000628244.1.89099 WP_000628244.1.91340 WP_000628244.1.93019 WP_000628244.1.93755 WP_000628244.1.9457 WP_000628244.1.94949 WP_000628244.1.95595 gi|16129339|ref|NP_415896.1| gi|170081055|ref|YP_001730375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]