SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh2_kg.5__892__AT3G45050.4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  59689.fgenesh2_kg.5__892__AT3G45050.4
Domain Number - Region: 88-110
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00102
Family DnaJ/Hsp40 cysteine-rich domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh2_kg.5__892__AT3G45050.4
Sequence length 163
Comment (Arabidopsis lyrata)
Sequence
MELSLKLQSFSFPSSVSTLTISLTFEVLFFVFEGVNNARFLKTRSLTVTPALAETAVSIA
IAATVVGTAATILARRSSKAAEEAEASTKECEACLGSGICPECKGEGFVLKKLSDANAEK
ARLTAKNMATRYTAGLPKKWSYCTKCSSTRSCITCGGSGKTSI
Download sequence
Identical sequences D7LNK3
XP_002875709.1.15461 jgi|Araly1|484900|fgenesh2_kg.5__892__AT3G45050.4 59689.fgenesh2_kg.5__892__AT3G45050.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]