SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.scaffold_702713.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.scaffold_702713.1
Domain Number 1 Region: 118-191
Classification Level Classification E-value
Superfamily Homeodomain-like 6.68e-19
Family Homeodomain 0.0043
Further Details:      
 
Weak hits

Sequence:  59689.scaffold_702713.1
Domain Number - Region: 191-237
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0484
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59689.scaffold_702713.1
Sequence length 283
Comment (Arabidopsis lyrata)
Sequence
MMMGKEDLGLSLRLGFAQNHHPLQLNLKPTSSSMSNLQMFPWNQTFVSSSDHQKQQSLRK
IDVNSLPTTVDLEEETGVSSPNSTISSTVSGKRRSEREGTSGGGAGDDLDITLDRSSSRG
TSDEEEDYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWF
QNRRARTKLKQTEVDCEYLKRCVEKLTDENRRLEKEAAELRALKLSPRLYGQMSPPTTLL
MCPSCERVAGPSSSNHNQRSVSLSPWLQMAHGPSTFDVMRPRS
Download sequence
Identical sequences D7MBY6
jgi|Araly1|914971|scaffold_702713.1 XP_002870101.1.15461 59689.scaffold_702713.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]