SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.scaffold_704211.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.scaffold_704211.1
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-20
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59689.scaffold_704211.1
Sequence length 162
Comment (Arabidopsis lyrata)
Sequence
MADQSLLHSPIKPHFFKPLLEGFRTHLNIPVAFFSKHVEGKNDQNKTVNLRSDASEKTWL
VKMDGLNLTDGWEDFAFSHDLRIGDIVVFRHEGEMVFHVTALGPSCCEIQYYTSSHNIND
DDRNDQTNIGKLLLSEMYSAKAKPKQRSQSDSSSDHSCFEAX
Download sequence
Identical sequences 59689.scaffold_704211.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]