SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000015194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000015194
Domain Number 1 Region: 399-429,752-794,935-1006,1036-1081
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-18
Family WD40-repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000015194
Domain Number - Region: 460-486
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0196
Family NfeD domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000015194
Sequence length 1082
Comment (Taeniopygia guttata)
Sequence
MTLTERLRERISRAFYSHGLLCAYPIPIILFTALCILACCSPLLKLPLPGTGPVEFSTPL
KDYAPPGAGPRHGEPGERPDWYVGAPVAYIQQILVKATVSPWQKNFLAVDVFRSPLARVF
QLVEEIRNHALRDSSGVRSLEEVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDRE
RFNADPDIITIHQHEPKTLQTSATLKELPTASFGNLSSIFLFTAAEGAQSLLSLISYVYW
SPDLYLLLPADVLLHHAPPLCSPLSRVPGCHIHMATDTPTARLAPQQPGWHPNSQTHTQT
TRLTPKQPGWQPCQAPTSTRLAPLPTLPATPTRCDTPPCAASHASLALPRGMQKQIAQAL
SLEMILQSQFVLHTWTKGIWETFCSRIQYLQLLQPHQLCSCFSPLSLFWVTGSLSSIPTR
SQSSGSCTSVDPKSQISIPAWSPDVPVPAASPESPPAARDRAVALKGDVWRCVSAHPAQA
GDRVVALPLLLRQGRGQDALSLSAPPAQAGTVIWIGILVYTDPAGLRTYLTSQVTEQSPL
GDAGLPAMPVPGGLPAGDPKVDLSVFPSEPVQLSENQTQQHWARGPEGRENGQLELGAEA
EVTWGAEDEEMWRKLSFRHWPALFSYYNITLAKRQISVILPAIPVTLYLKPQEALELRHP
QEASRYQPFLAEPGTPPERPAQPRAHQDVTLYKVAALGLASGMLLVLLLFCLYRVLCPKN
YGQNGPGRRRRGDLPCDDYGYSPPETEIVPLVLRGHLMDIQCLASDGMLLVSCCLVEKIR
VWKAQNGDCLTVIPKPRLRRDSSSIFDYQEGWDLSPDSKNGLEDSLESSQQLKRLLGPPQ
PPLFCDQPDLSSLIDTNFLERAGTAASEPRLRAVGARHDSGYDRARARQRRRQERHLPGA
LGPARPRRARPRGPQGDEPCAGCDRSSPPQSWGGDLESSIWSLELQGNLIVAGRSNGRLE
VWDAIEGTLRSSNDEGQSGITALVFLNNRIVAARLNGSLDFFSLETHTSLNHLQFRGGPG
RGSLPPSPELCRGAALRCRLTHGVPCAHHKPITALRAAAGRLVTGSQDHTLRVFRLEDSC
CL
Download sequence
Identical sequences H0ZX43
59729.ENSTGUP00000015194 ENSTGUP00000015194 ENSTGUP00000015194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]