SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 598659.NAMH_0991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  598659.NAMH_0991
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.2e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 598659.NAMH_0991
Sequence length 174
Comment (Nautilia profundicola AmH)
Sequence
MKYQIVVAGFGGQGVVFLVKVLSICAGKKGYKFLGTENHGMSQRGGSVSSHIKIGDFYNP
LIDLAQADLLIGLDKDEAILNLPYLKRGGNVVVNADEFPEIDANVFAVDANKLAEEGVFD
AKGLNVFMLGLTLARVKDFPFSVDEVKEAIEEINPKFAPQNFDILEKAIEYGKN
Download sequence
Identical sequences B9L9T3
598659.NAMH_0991 gi|224373019|ref|YP_002607391.1| WP_012663590.1.34156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]