SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59920.PMN2A_0821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59920.PMN2A_0821
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Formyltransferase 1.96e-27
Family Formyltransferase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59920.PMN2A_0821
Sequence length 130
Comment (Prochlorococcus marinus NATL2A)
Sequence
MKSDQLDKLLPLDTNLIVLAGYMPIISSKICAKWKGKLINTHPSLLPRYGGIGMYGVKVQ
EAVMAAKEIYGGCSVHYVSEKVDMGDLIRQKSIKINYEETPWQLGGHINKLERDLIVEVS
MFLKSKCITS
Download sequence
Identical sequences Q46JL6
gi|72382660|ref|YP_292015.1| 59920.PMN2A_0821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]