SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59922.P9303_02751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59922.P9303_02751
Domain Number 1 Region: 90-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000353
Family NfeD domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59922.P9303_02751
Sequence length 157
Comment (Prochlorococcus marinus MIT 9303)
Sequence
MAWASCFLFSFFILILVLVQEGIEGFLTACLLALAVSSVVAWLPLPFYIQVFILAGLSAL
LLLGLKKWERGSKSPLISRWNALRQNSEKDVSRGELALVLEGFSSSRPGAQLRVNWDGQS
WSARCLSSSREFLRGERVEVVGREGTCLIVAPLDAQQ
Download sequence
Identical sequences A2C6C0
gi|124021988|ref|YP_001016295.1| 59922.P9303_02751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]