SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59922.P9303_06891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59922.P9303_06891
Domain Number 1 Region: 90-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000126
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59922.P9303_06891
Sequence length 147
Comment (Prochlorococcus marinus MIT 9303)
Sequence
MPSPTWIPLIWLAVAGLLLAIELAQPSFDGLMFAALGALVVSILTAITPMPLIVQMIFFL
LITVLGTLWLTRWSARRNPSPGGLRQREDIAEVLTPIKAGGDGRVRWHGQSWAASSIDLE
TPINAGDQVVVMGREGTQLQVLPLPRR
Download sequence
Identical sequences A0A163CID2 A2C7I0
WP_011825355.1.68590 gi|124022398|ref|YP_001016705.1| 59922.P9303_06891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]