SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 604354.TSIB_0676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  604354.TSIB_0676
Domain Number 1 Region: 13-189
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.5e-29
Family Clp protease, ClpP subunit 0.0078
Further Details:      
 
Domain Number 2 Region: 371-438
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000327
Family NfeD domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 604354.TSIB_0676
Sequence length 451
Comment (Thermococcus sibiricus MM 739)
Sequence
MVVMRKILIAAFLFIFLTPALAQASVVYVAQIKGEITPYTYDQFDRYISEAERANANAII
ILLDTPGGRADAMQNIIERIKSAEVPVITYVYPPGGMAASAGTYIALGSHLIAMAPGTSI
GACRPILGYSQNGSIIEAPPKVVNFYASYIKSLAKASGRNETMVEKFITEDLAIDPEEAL
NSGVIEVIANDVNDLLEKAHGMKTKVPVRGEYVALDLEDAEIRYLEPSLKDRVIPYLTDP
AVAYVLLTLGIWALVLGFLSPGWHVPETVGAIMIVLAIIGLGYFGYRSAGLLLIVLAVIF
FIAEALTPTFGLFTVAGFITFVLGSIMLFGGGGEVDYLVSREVYSQIRLIIITIGALLAL
FFAFGMAAVIKARRKKAQTGKEEMIGLFGEVVEPLSPEGMIRARGELWRARSKDGKSIGI
GEKVRIVEMEGLKLIVVREKEKYPNEESKMR
Download sequence
Identical sequences C6A296
gi|242398666|ref|YP_002994090.1| 604354.TSIB_0676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]