SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 604354.TSIB_1469 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  604354.TSIB_1469
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.05e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 604354.TSIB_1469
Sequence length 170
Comment (Thermococcus sibiricus MM 739)
Sequence
MQIRLAGFGGQGVILAGVILGDAAAIEGLNVVQTQDYGSQSRGGHSIADLIISKDPIYDL
IVTKADVLLALAQLGYESTKESLKEGGLLIVDTGLVQPDKEFTGAPFTRIAEEKVGLALT
VNMVALGYLVAKTNVVKKESVEKAIRRRVPKGTEEINLKAFRTGYEEGMK
Download sequence
Identical sequences C6A4H5
604354.TSIB_1469 gi|242399444|ref|YP_002994869.1| WP_015849737.1.69891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]