SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 604354.TSIB_1651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  604354.TSIB_1651
Domain Number 1 Region: 65-126
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000131
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 604354.TSIB_1651
Sequence length 129
Comment (Thermococcus sibiricus MM 739)
Sequence
MKTYIKNILKILSILADEIVVGIFLFFILPRAGIEVPLKPALAVIGFLIFKDVIAVKFLW
EVFDKRVEVGPEALIGNDAIVVEELNPKGVVKVGNELWIAECLSGTAKKGEKVEIIEIRG
TKLLVKCQE
Download sequence
Identical sequences C6A507
gi|242399626|ref|YP_002995051.1| 604354.TSIB_1651 WP_015849918.1.69891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]