SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 60481.Shewmr7_0449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  60481.Shewmr7_0449
Domain Number - Region: 91-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000759
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 60481.Shewmr7_0449
Sequence length 156
Comment (Shewanella MR-7)
Sequence
MEFSNLILVWSIIGIILMLAELVIPGGIVVLLGAACLVVAGALWIGLVEGVVQSLTLWFI
SAIVLLLAFRQVTQKLVGGDSHVDNTDEELDIYNQIARVKQTIGPGQTTGRVEFQGSEWP
ALGDGSIIAAGTEVRIICRENIALVVEPVEQATSQN
Download sequence
Identical sequences A0A220UI74 Q0HZK3
gi|114045959|ref|YP_736509.1| gi|113971833|ref|YP_735626.1| 60480.Shewmr4_3503 60481.Shewmr7_0449 WP_011624234.1.3750 WP_011624234.1.3791 WP_011624234.1.64021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]