SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002155125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002155125
Domain Number 1 Region: 6-164
Classification Level Classification E-value
Superfamily UBC-like 2.82e-54
Family UBC-related 0.000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002155125
Sequence length 168
Comment (Hydra magnipapillata)
Sequence
MAIDQANLLLKRQLQELNKRPVEGFSAGLVDDENLLLWEVMVMGPPDSFYEGGFFKAHLI
FPKEYPQKPPKMKFISEFWHPNVAKDGDVCISILHEPGEDKFGYERPEERWLPIHTVETI
LLSVISMINEPNDESPANVDAAKEWRDHYETAFKKNVRRCVRKSQEFL
Download sequence
Identical sequences T2MEQ5
6085.XP_002155125 XP_012556450.1.79663 XP_012556451.1.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]