SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.C7TYB0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.C7TYB0
Domain Number 1 Region: 39-148
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-32
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6182.C7TYB0
Sequence length 176
Comment (Schistosoma japonicum)
Sequence
MTTIQRRYSTFSLSMNKFKAMDKANNPQGAKPNFGSGGKGAQPNAKQIMLDWCKAVTKGY
EGVDIQNFGSSWGDGLAFCALIHHFYPDAFDFSTLDPKNKRANFELAFEKAEKLGNVAPL
LDIEDLMRMKVPDWKCVFTQIQLYYRRFHLEEGKNAIVPPTGILPKAAPKQETTDE
Download sequence
Identical sequences C7TYB0
6182.C7TYB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]