SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.Q5C2S0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.Q5C2S0
Domain Number 1 Region: 55-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000984
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6182.Q5C2S0
Sequence length 147
Comment (Schistosoma japonicum)
Sequence
MCLYSMDSEIRKPVKSQQQQQQPQQQQVNNERLRTSLGTLNSLISATPNWTNDAVIGEHL
WNETTSTETCYVDESECTKSGVKRKCSVCHIICHVNCLPLVQVSCRPTFREAYIHDYRNE
RTYTTHHWVRRRKQIKSVNIVESHYNQ
Download sequence
Identical sequences Q5C2S0
6182.Q5C2S0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]