SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG15208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG15208
Domain Number 1 Region: 2-143,207-249
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.88e-44
Family Type II chitinase 0.00029
Further Details:      
 
Domain Number 2 Region: 139-202
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000788
Family Chitinase insertion domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG15208
Sequence length 254
Comment (Caenorhabditis briggsae)
Sequence
MLKSFNLNGVDIDWEFPVWSRDAKKIDKANFGTFLRILRSHLQNSGFKLSVAVSGPPTIS
RVAYDVEALAKYADMVQIMNYDFHVFNRYSNPLVGFNAPLHPMRAEISVLGEMNSESSMK
TWLDLGLPKNISYFGIPTYARAYQLLTHYLHKPYSPAIRSRPEITNYWDVCIFSKSGYYT
NVWNHNAQAPYLYGKDGLWISYENQQSILAKMAFARKWGVGGVMVYAVGSDDYHGKCGYG
RYPLLTKISKLARN
Download sequence
Identical sequences A8XLN8
CBG15208 6238.CBG15208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]