SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG26286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6238.CBG26286
Domain Number - Region: 10-74
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.0209
Family Cell division protein ZapA-like 0.011
Further Details:      
 
Domain Number - Region: 65-134
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG26286
Sequence length 205
Comment (Caenorhabditis briggsae)
Sequence
MLEVTEQHLHHADFRIDCLRSENHHLTLINEHLENKFAQLQGQFNIESYRRVMAEHSLYH
MSHESQSYKTQLEKSNLLENVIEQLKAVNSALAESQEEQQKAIEKEKLARQEEIDRLKVE
NFNLKEKVSDLKASLEICHQEMEEFSAIDNARSMCNVTNDKGFMALRRFGDTVAIRRLSG
NVNVLEPISEEFGEEGSEDSEKNCD
Download sequence
Identical sequences B6ILY4
CBG26286 6238.CBG26286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]