SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 62928.azo2268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  62928.azo2268
Domain Number 1 Region: 75-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000011
Family NfeD domain-like 0.0037
Further Details:      
 
Weak hits

Sequence:  62928.azo2268
Domain Number - Region: 22-69
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00706
Family LacY-like proton/sugar symporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 62928.azo2268
Sequence length 146
Comment (Azoarcus BH72)
Sequence
MSMEWWHWAVGGIALILLELVIPAFFVVWFGLGALLVALVALVADLSLTAQLVLWLLASV
AMMVLWFKVFEHRRHKTLSGTAEGDVIGEVGLLVGAIEAYGRGKVRFQRPVLGADEWICL
AETAIPAGERVRVVGIEGSFLRVTRA
Download sequence
Identical sequences A1K7T0
62928.azo2268 WP_011765999.1.91620 gi|119898559|ref|YP_933772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]