SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 62928.azo2406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  62928.azo2406
Domain Number 1 Region: 734-975
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-20
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 
Domain Number 2 Region: 49-226
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.82e-16
Family Pyruvate oxidase and decarboxylase Pyr module 0.043
Further Details:      
 
Domain Number 3 Region: 443-629
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000124
Family PFOR PP module 0.041
Further Details:      
 
Weak hits

Sequence:  62928.azo2406
Domain Number - Region: 273-401
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00011
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 62928.azo2406
Sequence length 1194
Comment (Azoarcus BH72)
Sequence
MKAEAFPPQIRTDYRLADSLQAMSGQIFLTGTQALVRLPLMQAALDAAAGRNTGGFISGY
RGSPLGAYDQQLWKAKALLDANRIRFLPAVNEELGATAVLGTQQVEGDAERTVDGVFAIW
YGKGPGVDRAGDALRHGNAYGASPHGGVLAVIGDDHGCVSSSMPHQSDFTLQAWGLPVLN
PASVAEMLEFGLYGWALSRYSGCWVGLKAISETVESASTVDLDAIRTRFDGVPEFTPPAT
GLHYRWPDLPSLVIEQRLHAKLDAARAFAAANPIDKTICAAPQADIGIVSCGKAHLDLLE
AFRRLGVSLADLEAAGIRFYKVGQSFPLETARMRAFATGLKEILVVEEKGPVIERQIKEL
FYNADPAERPLVIGKSGRDGAPLLSALGELRPSRVIPVIAAWLAGHRPEIEQRAHVVEHV
TDFTPPPLLSNEADGVRRVPYFCSGCPHNTSTKVPEGSHAQAGIGCHFMASWMPDRETTG
LIQMGGEGVDWVAHSAFTRTPHVFQNLGDGTYFHSGFLAIRQAIAAGTNVTYKILYNDAV
AMTGGQPVDGTVTVDAIARQVEAEGARRVAVVSDEPEKYDGHEGLFPRGTSFHHRAELDA
VQRELREVKGVTVLIYDQTCAAEKRRRRKKQAYPDPARRIFINDAVCEGCGDCGKQSNCL
SIVPVDTPFGRKRAIDQSSCNKDYSCVNGFCPSFVSVLGGSLKKPTGPAFDAARLDELVG
TLPLPKAWCWDAPYDLLVTGVGGTGVVTVGALITMAAHLEGKSASVLDFMGFAQKGGQVL
SFVRLGADASVLNQVRIDAQQADAILACDLVVGASNDALLTARHGRTRIVANVHEIQTAR
FVQDPDADLHVDALLAKMRYAAGDDRLDTCDAQALCARFLGDTMGANILLMGYAWQRGLI
PVSLAALDRAIELNGVAVAMNRSAFRIGRLAAAGAEALAALAAGPLAQPEVADSLGAIVA
LHAAHLTGYQNAAYAARYTAFIDKVAAAERKALGADAPLRLAPVVARTYGKLLAYKDEYE
VARLYTDGRFRQALEAQFEGDYRLQFHMAPPLLAKPGPNGRPKKMDFGPRLMPLLRLLAA
ARGLRGTAFDLFGRSEERRMERELAADYARAIDALLPRLAADTVDAAVEFAGLAEGVRGF
GPVKLANLRTVKQRERVLLHTLGVDVAHGATIAHLLAQAPRGAEALRGIPVVAK
Download sequence
Identical sequences A1K868
gi|119898697|ref|YP_933910.1| 62928.azo2406 WP_011766137.1.91620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]