SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 62977.ACIAD2549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  62977.ACIAD2549
Domain Number 1 Region: 43-221
Classification Level Classification E-value
Superfamily Folate-binding domain 3.14e-19
Family Aminomethyltransferase folate-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 62977.ACIAD2549
Sequence length 223
Comment (Acinetobacter sp ADP1)
Sequence
MQSLYQAERSPIEIGGSQVAYQSFGLGKRFLHDQTPSSPINISQCTMIDLTNLSRVGFRG
QDAAAYLSSYGFQLPQQPNQAIQQEDGCWVMRLSLTEYCVLGSLQDFGERVSHLEQGWQM
DERANYLLPRQDSHAWIQLTGAPIAEVMAKLCAVDMRLNVFQVGQIAQTSVGRINAIVVN
VSDPSIQKFNILCDRAAVLYLWGVLQDAIQEFDGKIAGINTLL
Download sequence
Identical sequences A0A2D7VBK1 Q6F9F0
62977.ACIAD2549 WP_011182550.1.60904 WP_011182550.1.84452 gi|50085626|ref|YP_047136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]