SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 62977.ACIAD2966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  62977.ACIAD2966
Domain Number 1 Region: 83-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000248
Family NfeD domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 62977.ACIAD2966
Sequence length 156
Comment (Acinetobacter sp ADP1)
Sequence
MEFILEPWHWFVLGILLMLSELVITAFAALWFGIAAIMVSVLLWLFPMMGITTQVIMWII
LSVLCTLLWFKFIKPLSIDKTKAGLSREATIGQIGMVIRVGLSHEQIVVRFALPVLGADE
WNCRSLAPVEVGDRVCVVDIMGNDLVVQPHIPINNK
Download sequence
Identical sequences A0A2D7VAV7 Q6F8D8
62977.ACIAD2966 GO.2753 WP_004929582.1.43955 WP_004929582.1.60904 WP_004929582.1.84452 WP_004929582.1.9579 WP_004929582.1.98780 gi|50085989|ref|YP_047499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]