SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 632772.ROP_13560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  632772.ROP_13560
Domain Number 1 Region: 85-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000628
Family NfeD domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 632772.ROP_13560
Sequence length 155
Comment (Rhodococcus opacus B4)
Sequence
MTALGVLALVLGVLLIVVEAHAPTAGVLGGLGALFVGAGVWLLFTSSDTAQMIAIPAAAG
VAVVGVGLAVVGGRKALAAGHSPVRTGMQSLIGSDATVRNWKGRQGQVEAAGSLWRAQTL
FGDDETPTAGDSVIVEQIRGLTLTVRRREPWELEL
Download sequence
Identical sequences C1AX99
WP_012688575.1.34288 632772.ROP_13560 gi|226360770|ref|YP_002778548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]