SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 632772.ROP_70060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  632772.ROP_70060
Domain Number 1 Region: 79-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000837
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 632772.ROP_70060
Sequence length 143
Comment (Rhodococcus opacus B4)
Sequence
MAALIWLVAGVLLAAAEALTGDFFLLMLAGGALATAGVTAITDFPVWVDAVIFGVLSLAL
ILGVRPVLLRKFETPPPTPTGIEALTGKQALVLEEVAEHAGQIKLGGDVWTARPLDSTEV
YPPGTTVTVMQIDGATAVVWRGP
Download sequence
Identical sequences A0A076EKE9 A0A135GQ40 A0A149ZV28 A0A2A3GPZ9 C1B4R4 X0RAC4
WP_005241863.1.100430 WP_005241863.1.11980 WP_005241863.1.33616 WP_005241863.1.34288 WP_005241863.1.36929 WP_005241863.1.53434 WP_005241863.1.59368 WP_005241863.1.60566 WP_005241863.1.65071 WP_005241863.1.78234 WP_005241863.1.84796 WP_005241863.1.86984 WP_005241863.1.99080 gi|226366415|ref|YP_002784198.1| 632772.ROP_70060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]