SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 632772.ROP_71780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  632772.ROP_71780
Domain Number 1 Region: 239-500
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-61
Family PFOR Pyr module 0.059
Further Details:      
 
Domain Number 2 Region: 20-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0079
Further Details:      
 
Domain Number 3 Region: 519-616
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000121
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 632772.ROP_71780
Sequence length 642
Comment (Rhodococcus opacus B4)
Sequence
MESTTQSATGPVTKLEQVVIRIAGDSGDGMQLAGDQFTAEAAAFGNDLATQPNFPAEIRA
PQGTLPGVSSFQIQIAEYDILTAGDRPDVLVAMNPAALKANIGDLPRGGTLIVNSDEFTK
RNLSKVGYDGDPLETAEFEDYQIHEIAMATLTLGAVESVGLGKKDAERSKNMFALGVLSW
MYGRPLAAIEEFLASKFAKKPDIAKANVLALRAGWNYGETTESFATSFEVAPATLPTGTY
RQVTGNTALAYGLLAAGRTSGMDVFLGTYPITPASDILHELSKHKHFGVVTFQAEDEISG
IGAALGASYGGALGVTSTSGPGLALKSEAIGLAVMTELPLVIVDVQRGGPSTGLPTKTEQ
SDLLQALYGRNGESPVAVIAPQSPADCFDAALEAAQIAVTYRTPVLVLSDGAIANGSEPW
SIPDVGALPPIDPAFAVTGHGGGADGGYLPYARDPQTLARDWAVPGSAGLEHRIGGLEKE
NGSGDISYTDVNHELMTRIRAAKIAGIEVPDLIVDDPDADADVLVIGWGSSYGPIGEAVR
RMRHGGNKIARAHLRHLNPMPANLAEVLTGYRRVLVPEMNLGQLSMLLRARFDADIQPVT
KVSGMAFRADELHEAFLQEFGGTLAASESAKTPAARAAVVTR
Download sequence
Identical sequences C1B614
gi|226366587|ref|YP_002784370.1| 632772.ROP_71780 WP_015890840.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]