SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 634178.Lm4b_00409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  634178.Lm4b_00409
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000157
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 634178.Lm4b_00409
Sequence length 99
Comment (Listeria monocytogenes Clip81459)
Sequence
MKHNFTEDDFVYGESWGLVHRGVLEDKEVERMKALRDKVVGKKGVAQTTLKPIGSVRIDG
EVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK
Download sequence
Identical sequences A0A0E1R2R8 A0A241SLM0 A0A255BU83 A0A2G8QMI1 A0A2G8QN54 A0A2G8R295 A0A2G8R4K6 E3YM38 Q8Y9X6
gi|404279941|ref|YP_006680839.1| gi|470209188|ref|YP_007605762.1| 169963.lmo0391 265669.LMOf2365_0403 634178.Lm4b_00409 gi|46906622|ref|YP_013011.1| gi|404412485|ref|YP_006698072.1| NP_463921.1.42710 WP_003741454.1.100045 WP_003741454.1.100078 WP_003741454.1.100112 WP_003741454.1.100142 WP_003741454.1.100147 WP_003741454.1.100160 WP_003741454.1.100221 WP_003741454.1.100229 WP_003741454.1.100261 WP_003741454.1.10039 WP_003741454.1.100458 WP_003741454.1.100510 WP_003741454.1.100522 WP_003741454.1.100530 WP_003741454.1.10073 WP_003741454.1.101057 WP_003741454.1.101093 WP_003741454.1.10112 WP_003741454.1.101144 WP_003741454.1.101184 WP_003741454.1.101252 WP_003741454.1.101318 WP_003741454.1.101368 WP_003741454.1.101527 WP_003741454.1.101529 WP_003741454.1.101688 WP_003741454.1.101752 WP_003741454.1.10176 WP_003741454.1.101772 WP_003741454.1.101811 WP_003741454.1.10182 WP_003741454.1.10186 WP_003741454.1.101945 WP_003741454.1.10210 WP_003741454.1.102145 WP_003741454.1.102150 WP_003741454.1.10418 WP_003741454.1.10420 WP_003741454.1.10444 WP_003741454.1.10460 WP_003741454.1.11086 WP_003741454.1.11177 WP_003741454.1.11266 WP_003741454.1.11313 WP_003741454.1.11326 WP_003741454.1.11419 WP_003741454.1.1146 WP_003741454.1.1160 WP_003741454.1.11686 WP_003741454.1.11689 WP_003741454.1.11712 WP_003741454.1.11738 WP_003741454.1.11779 WP_003741454.1.11788 WP_003741454.1.11851 WP_003741454.1.11907 WP_003741454.1.11940 WP_003741454.1.11973 WP_003741454.1.11976 WP_003741454.1.12020 WP_003741454.1.12028 WP_003741454.1.12037 WP_003741454.1.12142 WP_003741454.1.12143 WP_003741454.1.12148 WP_003741454.1.12278 WP_003741454.1.12287 WP_003741454.1.12377 WP_003741454.1.12417 WP_003741454.1.12544 WP_003741454.1.12824 WP_003741454.1.12988 WP_003741454.1.12993 WP_003741454.1.13004 WP_003741454.1.13105 WP_003741454.1.13134 WP_003741454.1.13160 WP_003741454.1.13180 WP_003741454.1.13304 WP_003741454.1.13329 WP_003741454.1.1336 WP_003741454.1.13360 WP_003741454.1.13428 WP_003741454.1.13684 WP_003741454.1.13695 WP_003741454.1.137 WP_003741454.1.13779 WP_003741454.1.13833 WP_003741454.1.13847 WP_003741454.1.13855 WP_003741454.1.13921 WP_003741454.1.14072 WP_003741454.1.14103 WP_003741454.1.14339 WP_003741454.1.14636 WP_003741454.1.14641 WP_003741454.1.14832 WP_003741454.1.14875 WP_003741454.1.14895 WP_003741454.1.15085 WP_003741454.1.15122 WP_003741454.1.15340 WP_003741454.1.15342 WP_003741454.1.15495 WP_003741454.1.155 WP_003741454.1.15518 WP_003741454.1.15564 WP_003741454.1.15618 WP_003741454.1.15619 WP_003741454.1.15659 WP_003741454.1.1575 WP_003741454.1.1576 WP_003741454.1.15816 WP_003741454.1.15847 WP_003741454.1.16207 WP_003741454.1.16403 WP_003741454.1.16499 WP_003741454.1.16516 WP_003741454.1.1657 WP_003741454.1.16631 WP_003741454.1.16634 WP_003741454.1.1667 WP_003741454.1.16726 WP_003741454.1.16746 WP_003741454.1.1678 WP_003741454.1.1688 WP_003741454.1.17106 WP_003741454.1.17131 WP_003741454.1.17228 WP_003741454.1.17375 WP_003741454.1.17398 WP_003741454.1.17399 WP_003741454.1.17604 WP_003741454.1.17644 WP_003741454.1.17695 WP_003741454.1.17774 WP_003741454.1.178 WP_003741454.1.17947 WP_003741454.1.18026 WP_003741454.1.1803 WP_003741454.1.18046 WP_003741454.1.18222 WP_003741454.1.18289 WP_003741454.1.18463 WP_003741454.1.18576 WP_003741454.1.18648 WP_003741454.1.18677 WP_003741454.1.18689 WP_003741454.1.18721 WP_003741454.1.18833 WP_003741454.1.18979 WP_003741454.1.19080 WP_003741454.1.19112 WP_003741454.1.19167 WP_003741454.1.19195 WP_003741454.1.19246 WP_003741454.1.1929 WP_003741454.1.19371 WP_003741454.1.19372 WP_003741454.1.19409 WP_003741454.1.19443 WP_003741454.1.1947 WP_003741454.1.19472 WP_003741454.1.19542 WP_003741454.1.19548 WP_003741454.1.19549 WP_003741454.1.19584 WP_003741454.1.19607 WP_003741454.1.19615 WP_003741454.1.19685 WP_003741454.1.197 WP_003741454.1.19901 WP_003741454.1.20263 WP_003741454.1.20378 WP_003741454.1.20402 WP_003741454.1.20416 WP_003741454.1.20548 WP_003741454.1.20672 WP_003741454.1.21046 WP_003741454.1.21099 WP_003741454.1.21133 WP_003741454.1.21338 WP_003741454.1.21371 WP_003741454.1.21428 WP_003741454.1.21429 WP_003741454.1.21527 WP_003741454.1.21529 WP_003741454.1.21542 WP_003741454.1.21567 WP_003741454.1.21597 WP_003741454.1.21705 WP_003741454.1.21706 WP_003741454.1.21711 WP_003741454.1.21874 WP_003741454.1.21884 WP_003741454.1.21889 WP_003741454.1.21926 WP_003741454.1.21995 WP_003741454.1.22099 WP_003741454.1.22154 WP_003741454.1.22188 WP_003741454.1.22190 WP_003741454.1.22194 WP_003741454.1.22221 WP_003741454.1.22434 WP_003741454.1.22468 WP_003741454.1.22597 WP_003741454.1.22656 WP_003741454.1.22776 WP_003741454.1.23060 WP_003741454.1.23139 WP_003741454.1.23254 WP_003741454.1.23255 WP_003741454.1.23291 WP_003741454.1.2340 WP_003741454.1.23425 WP_003741454.1.23433 WP_003741454.1.23448 WP_003741454.1.23582 WP_003741454.1.23624 WP_003741454.1.23650 WP_003741454.1.2368 WP_003741454.1.23781 WP_003741454.1.23828 WP_003741454.1.23848 WP_003741454.1.24048 WP_003741454.1.24075 WP_003741454.1.24115 WP_003741454.1.2422 WP_003741454.1.24335 WP_003741454.1.24349 WP_003741454.1.24370 WP_003741454.1.24411 WP_003741454.1.24422 WP_003741454.1.24531 WP_003741454.1.24600 WP_003741454.1.24651 WP_003741454.1.24667 WP_003741454.1.24818 WP_003741454.1.24836 WP_003741454.1.24847 WP_003741454.1.24867 WP_003741454.1.24934 WP_003741454.1.24945 WP_003741454.1.24972 WP_003741454.1.24975 WP_003741454.1.25020 WP_003741454.1.25057 WP_003741454.1.25300 WP_003741454.1.25401 WP_003741454.1.2545 WP_003741454.1.25456 WP_003741454.1.25471 WP_003741454.1.25500 WP_003741454.1.25616 WP_003741454.1.25746 WP_003741454.1.25805 WP_003741454.1.25830 WP_003741454.1.25896 WP_003741454.1.26052 WP_003741454.1.26103 WP_003741454.1.26139 WP_003741454.1.26145 WP_003741454.1.26170 WP_003741454.1.26320 WP_003741454.1.26322 WP_003741454.1.26350 WP_003741454.1.26406 WP_003741454.1.26632 WP_003741454.1.26634 WP_003741454.1.2666 WP_003741454.1.26891 WP_003741454.1.26957 WP_003741454.1.27056 WP_003741454.1.27132 WP_003741454.1.27143 WP_003741454.1.27200 WP_003741454.1.27231 WP_003741454.1.27281 WP_003741454.1.27517 WP_003741454.1.27669 WP_003741454.1.27681 WP_003741454.1.27728 WP_003741454.1.27826 WP_003741454.1.27860 WP_003741454.1.27891 WP_003741454.1.27948 WP_003741454.1.28042 WP_003741454.1.28060 WP_003741454.1.28098 WP_003741454.1.2824 WP_003741454.1.28260 WP_003741454.1.28297 WP_003741454.1.28369 WP_003741454.1.28402 WP_003741454.1.2855 WP_003741454.1.28722 WP_003741454.1.28747 WP_003741454.1.28792 WP_003741454.1.28803 WP_003741454.1.28804 WP_003741454.1.28818 WP_003741454.1.2920 WP_003741454.1.29309 WP_003741454.1.29331 WP_003741454.1.29550 WP_003741454.1.29558 WP_003741454.1.29562 WP_003741454.1.29565 WP_003741454.1.29569 WP_003741454.1.29634 WP_003741454.1.29705 WP_003741454.1.29738 WP_003741454.1.29762 WP_003741454.1.29803 WP_003741454.1.29872 WP_003741454.1.29912 WP_003741454.1.30124 WP_003741454.1.30193 WP_003741454.1.30227 WP_003741454.1.30267 WP_003741454.1.30273 WP_003741454.1.30372 WP_003741454.1.30430 WP_003741454.1.305 WP_003741454.1.30660 WP_003741454.1.30837 WP_003741454.1.30851 WP_003741454.1.3103 WP_003741454.1.31062 WP_003741454.1.31108 WP_003741454.1.31116 WP_003741454.1.31289 WP_003741454.1.31305 WP_003741454.1.31329 WP_003741454.1.31444 WP_003741454.1.31485 WP_003741454.1.31584 WP_003741454.1.31691 WP_003741454.1.31830 WP_003741454.1.31966 WP_003741454.1.3206 WP_003741454.1.32061 WP_003741454.1.32140 WP_003741454.1.32210 WP_003741454.1.32240 WP_003741454.1.32278 WP_003741454.1.32402 WP_003741454.1.32472 WP_003741454.1.32597 WP_003741454.1.32622 WP_003741454.1.32648 WP_003741454.1.32681 WP_003741454.1.32698 WP_003741454.1.32767 WP_003741454.1.32817 WP_003741454.1.33016 WP_003741454.1.3314 WP_003741454.1.3324 WP_003741454.1.33282 WP_003741454.1.33336 WP_003741454.1.33591 WP_003741454.1.33688 WP_003741454.1.33875 WP_003741454.1.3393 WP_003741454.1.33995 WP_003741454.1.34369 WP_003741454.1.34698 WP_003741454.1.34714 WP_003741454.1.34732 WP_003741454.1.34790 WP_003741454.1.34849 WP_003741454.1.34851 WP_003741454.1.34911 WP_003741454.1.350 WP_003741454.1.3511 WP_003741454.1.35135 WP_003741454.1.35350 WP_003741454.1.35402 WP_003741454.1.35450 WP_003741454.1.35452 WP_003741454.1.35514 WP_003741454.1.35738 WP_003741454.1.35979 WP_003741454.1.36108 WP_003741454.1.36115 WP_003741454.1.3613 WP_003741454.1.36203 WP_003741454.1.36241 WP_003741454.1.364 WP_003741454.1.36599 WP_003741454.1.36877 WP_003741454.1.36936 WP_003741454.1.37023 WP_003741454.1.37278 WP_003741454.1.37426 WP_003741454.1.37466 WP_003741454.1.37471 WP_003741454.1.37518 WP_003741454.1.37561 WP_003741454.1.37665 WP_003741454.1.37723 WP_003741454.1.3782 WP_003741454.1.37900 WP_003741454.1.37927 WP_003741454.1.37951 WP_003741454.1.37986 WP_003741454.1.38015 WP_003741454.1.38025 WP_003741454.1.38076 WP_003741454.1.38224 WP_003741454.1.38302 WP_003741454.1.38382 WP_003741454.1.38396 WP_003741454.1.384 WP_003741454.1.38424 WP_003741454.1.38471 WP_003741454.1.38528 WP_003741454.1.3853 WP_003741454.1.38575 WP_003741454.1.38733 WP_003741454.1.38741 WP_003741454.1.38819 WP_003741454.1.38833 WP_003741454.1.3892 WP_003741454.1.39000 WP_003741454.1.39115 WP_003741454.1.3919 WP_003741454.1.39218 WP_003741454.1.39307 WP_003741454.1.39316 WP_003741454.1.39348 WP_003741454.1.39427 WP_003741454.1.39496 WP_003741454.1.39554 WP_003741454.1.3959 WP_003741454.1.39630 WP_003741454.1.39794 WP_003741454.1.39871 WP_003741454.1.39887 WP_003741454.1.39895 WP_003741454.1.40124 WP_003741454.1.40245 WP_003741454.1.404 WP_003741454.1.40420 WP_003741454.1.405 WP_003741454.1.40556 WP_003741454.1.40580 WP_003741454.1.40720 WP_003741454.1.40820 WP_003741454.1.40841 WP_003741454.1.40953 WP_003741454.1.40978 WP_003741454.1.41023 WP_003741454.1.41281 WP_003741454.1.41337 WP_003741454.1.4166 WP_003741454.1.41700 WP_003741454.1.41876 WP_003741454.1.41903 WP_003741454.1.41909 WP_003741454.1.41955 WP_003741454.1.41970 WP_003741454.1.42010 WP_003741454.1.42040 WP_003741454.1.42089 WP_003741454.1.42127 WP_003741454.1.4218 WP_003741454.1.42310 WP_003741454.1.42317 WP_003741454.1.42339 WP_003741454.1.42525 WP_003741454.1.42550 WP_003741454.1.42564 WP_003741454.1.42615 WP_003741454.1.42672 WP_003741454.1.42926 WP_003741454.1.42958 WP_003741454.1.42994 WP_003741454.1.43060 WP_003741454.1.43135 WP_003741454.1.43267 WP_003741454.1.43280 WP_003741454.1.43304 WP_003741454.1.43336 WP_003741454.1.43350 WP_003741454.1.43458 WP_003741454.1.43480 WP_003741454.1.43619 WP_003741454.1.4371 WP_003741454.1.43768 WP_003741454.1.43807 WP_003741454.1.43916 WP_003741454.1.44023 WP_003741454.1.44092 WP_003741454.1.44106 WP_003741454.1.44161 WP_003741454.1.44230 WP_003741454.1.44427 WP_003741454.1.44596 WP_003741454.1.44645 WP_003741454.1.44663 WP_003741454.1.44703 WP_003741454.1.4472 WP_003741454.1.44749 WP_003741454.1.4479 WP_003741454.1.44806 WP_003741454.1.44924 WP_003741454.1.4503 WP_003741454.1.45309 WP_003741454.1.45355 WP_003741454.1.45512 WP_003741454.1.45524 WP_003741454.1.45541 WP_003741454.1.4562 WP_003741454.1.45708 WP_003741454.1.45719 WP_003741454.1.45758 WP_003741454.1.45778 WP_003741454.1.4578 WP_003741454.1.45811 WP_003741454.1.4587 WP_003741454.1.45883 WP_003741454.1.45893 WP_003741454.1.45983 WP_003741454.1.45994 WP_003741454.1.4604 WP_003741454.1.4615 WP_003741454.1.46154 WP_003741454.1.46180 WP_003741454.1.46277 WP_003741454.1.4642 WP_003741454.1.46425 WP_003741454.1.46456 WP_003741454.1.46566 WP_003741454.1.46711 WP_003741454.1.46725 WP_003741454.1.46834 WP_003741454.1.46863 WP_003741454.1.46867 WP_003741454.1.46981 WP_003741454.1.47001 WP_003741454.1.47055 WP_003741454.1.47075 WP_003741454.1.47384 WP_003741454.1.47412 WP_003741454.1.47431 WP_003741454.1.47518 WP_003741454.1.47520 WP_003741454.1.4753 WP_003741454.1.47593 WP_003741454.1.47650 WP_003741454.1.4766 WP_003741454.1.47759 WP_003741454.1.47952 WP_003741454.1.47953 WP_003741454.1.47979 WP_003741454.1.48007 WP_003741454.1.48161 WP_003741454.1.48163 WP_003741454.1.48175 WP_003741454.1.48180 WP_003741454.1.48235 WP_003741454.1.48358 WP_003741454.1.48410 WP_003741454.1.48435 WP_003741454.1.48440 WP_003741454.1.48441 WP_003741454.1.48471 WP_003741454.1.48565 WP_003741454.1.48572 WP_003741454.1.48661 WP_003741454.1.48854 WP_003741454.1.48999 WP_003741454.1.49 WP_003741454.1.49146 WP_003741454.1.49202 WP_003741454.1.49205 WP_003741454.1.49390 WP_003741454.1.49391 WP_003741454.1.49415 WP_003741454.1.49458 WP_003741454.1.49467 WP_003741454.1.49507 WP_003741454.1.49604 WP_003741454.1.49668 WP_003741454.1.49708 WP_003741454.1.4974 WP_003741454.1.49754 WP_003741454.1.49952 WP_003741454.1.49962 WP_003741454.1.50044 WP_003741454.1.50063 WP_003741454.1.50073 WP_003741454.1.5020 WP_003741454.1.50236 WP_003741454.1.50237 WP_003741454.1.50243 WP_003741454.1.50288 WP_003741454.1.50293 WP_003741454.1.50334 WP_003741454.1.50482 WP_003741454.1.50662 WP_003741454.1.50765 WP_003741454.1.50775 WP_003741454.1.50862 WP_003741454.1.50883 WP_003741454.1.50898 WP_003741454.1.51086 WP_003741454.1.51262 WP_003741454.1.5129 WP_003741454.1.51318 WP_003741454.1.51384 WP_003741454.1.51493 WP_003741454.1.51510 WP_003741454.1.5170 WP_003741454.1.51720 WP_003741454.1.51732 WP_003741454.1.5175 WP_003741454.1.51768 WP_003741454.1.51980 WP_003741454.1.52142 WP_003741454.1.52177 WP_003741454.1.52290 WP_003741454.1.52371 WP_003741454.1.52395 WP_003741454.1.52420 WP_003741454.1.52447 WP_003741454.1.52507 WP_003741454.1.52617 WP_003741454.1.52684 WP_003741454.1.52725 WP_003741454.1.52782 WP_003741454.1.52829 WP_003741454.1.52867 WP_003741454.1.52989 WP_003741454.1.53051 WP_003741454.1.53102 WP_003741454.1.53161 WP_003741454.1.5317 WP_003741454.1.53193 WP_003741454.1.53266 WP_003741454.1.53378 WP_003741454.1.53426 WP_003741454.1.53536 WP_003741454.1.53603 WP_003741454.1.53870 WP_003741454.1.53877 WP_003741454.1.53920 WP_003741454.1.54155 WP_003741454.1.54160 WP_003741454.1.5417 WP_003741454.1.54281 WP_003741454.1.54434 WP_003741454.1.54505 WP_003741454.1.54508 WP_003741454.1.54564 WP_003741454.1.54639 WP_003741454.1.54646 WP_003741454.1.54740 WP_003741454.1.54750 WP_003741454.1.54884 WP_003741454.1.54890 WP_003741454.1.55027 WP_003741454.1.55068 WP_003741454.1.5514 WP_003741454.1.55238 WP_003741454.1.5538 WP_003741454.1.55386 WP_003741454.1.55423 WP_003741454.1.55487 WP_003741454.1.55494 WP_003741454.1.55510 WP_003741454.1.55609 WP_003741454.1.55683 WP_003741454.1.55740 WP_003741454.1.55797 WP_003741454.1.55824 WP_003741454.1.55847 WP_003741454.1.55850 WP_003741454.1.55890 WP_003741454.1.5601 WP_003741454.1.56269 WP_003741454.1.56322 WP_003741454.1.56344 WP_003741454.1.56415 WP_003741454.1.56526 WP_003741454.1.56557 WP_003741454.1.56566 WP_003741454.1.5671 WP_003741454.1.56748 WP_003741454.1.56759 WP_003741454.1.5687 WP_003741454.1.57106 WP_003741454.1.57132 WP_003741454.1.57171 WP_003741454.1.57228 WP_003741454.1.57374 WP_003741454.1.57404 WP_003741454.1.57504 WP_003741454.1.57505 WP_003741454.1.57536 WP_003741454.1.57547 WP_003741454.1.57578 WP_003741454.1.57625 WP_003741454.1.57766 WP_003741454.1.57913 WP_003741454.1.57932 WP_003741454.1.57948 WP_003741454.1.57963 WP_003741454.1.57979 WP_003741454.1.58 WP_003741454.1.58030 WP_003741454.1.58069 WP_003741454.1.58083 WP_003741454.1.58088 WP_003741454.1.58177 WP_003741454.1.58491 WP_003741454.1.58516 WP_003741454.1.58532 WP_003741454.1.58544 WP_003741454.1.58661 WP_003741454.1.58828 WP_003741454.1.58966 WP_003741454.1.59045 WP_003741454.1.59113 WP_003741454.1.59343 WP_003741454.1.59353 WP_003741454.1.59493 WP_003741454.1.59542 WP_003741454.1.59652 WP_003741454.1.59695 WP_003741454.1.59720 WP_003741454.1.5973 WP_003741454.1.59744 WP_003741454.1.59799 WP_003741454.1.59826 WP_003741454.1.59937 WP_003741454.1.59949 WP_003741454.1.59975 WP_003741454.1.59984 WP_003741454.1.60132 WP_003741454.1.60162 WP_003741454.1.60166 WP_003741454.1.60191 WP_003741454.1.60219 WP_003741454.1.60295 WP_003741454.1.60346 WP_003741454.1.60369 WP_003741454.1.60543 WP_003741454.1.60665 WP_003741454.1.60674 WP_003741454.1.60762 WP_003741454.1.60766 WP_003741454.1.60768 WP_003741454.1.61002 WP_003741454.1.61072 WP_003741454.1.611 WP_003741454.1.61109 WP_003741454.1.61244 WP_003741454.1.61274 WP_003741454.1.61358 WP_003741454.1.61371 WP_003741454.1.61384 WP_003741454.1.61525 WP_003741454.1.61824 WP_003741454.1.61894 WP_003741454.1.61915 WP_003741454.1.62177 WP_003741454.1.6236 WP_003741454.1.62375 WP_003741454.1.62430 WP_003741454.1.62494 WP_003741454.1.62573 WP_003741454.1.62655 WP_003741454.1.62663 WP_003741454.1.62690 WP_003741454.1.6281 WP_003741454.1.62874 WP_003741454.1.62904 WP_003741454.1.62972 WP_003741454.1.63209 WP_003741454.1.63269 WP_003741454.1.63283 WP_003741454.1.63315 WP_003741454.1.63359 WP_003741454.1.63605 WP_003741454.1.63676 WP_003741454.1.63842 WP_003741454.1.63883 WP_003741454.1.63951 WP_003741454.1.6397 WP_003741454.1.64041 WP_003741454.1.64147 WP_003741454.1.64200 WP_003741454.1.64227 WP_003741454.1.64259 WP_003741454.1.64289 WP_003741454.1.64413 WP_003741454.1.64587 WP_003741454.1.6460 WP_003741454.1.64796 WP_003741454.1.648 WP_003741454.1.64869 WP_003741454.1.64929 WP_003741454.1.65094 WP_003741454.1.65143 WP_003741454.1.65213 WP_003741454.1.65309 WP_003741454.1.65376 WP_003741454.1.65392 WP_003741454.1.65561 WP_003741454.1.65730 WP_003741454.1.65780 WP_003741454.1.6579 WP_003741454.1.65827 WP_003741454.1.65840 WP_003741454.1.66005 WP_003741454.1.66039 WP_003741454.1.66057 WP_003741454.1.66134 WP_003741454.1.66138 WP_003741454.1.66184 WP_003741454.1.66285 WP_003741454.1.66311 WP_003741454.1.66338 WP_003741454.1.66510 WP_003741454.1.66512 WP_003741454.1.66545 WP_003741454.1.66596 WP_003741454.1.6672 WP_003741454.1.66743 WP_003741454.1.66884 WP_003741454.1.66903 WP_003741454.1.66993 WP_003741454.1.67165 WP_003741454.1.67301 WP_003741454.1.6731 WP_003741454.1.67352 WP_003741454.1.67408 WP_003741454.1.6745 WP_003741454.1.67551 WP_003741454.1.67573 WP_003741454.1.6763 WP_003741454.1.67654 WP_003741454.1.67668 WP_003741454.1.67694 WP_003741454.1.67709 WP_003741454.1.67813 WP_003741454.1.67926 WP_003741454.1.68112 WP_003741454.1.68123 WP_003741454.1.68128 WP_003741454.1.68197 WP_003741454.1.68208 WP_003741454.1.68236 WP_003741454.1.68282 WP_003741454.1.68301 WP_003741454.1.68321 WP_003741454.1.68414 WP_003741454.1.68497 WP_003741454.1.68517 WP_003741454.1.68525 WP_003741454.1.68528 WP_003741454.1.68740 WP_003741454.1.69190 WP_003741454.1.69263 WP_003741454.1.69265 WP_003741454.1.69360 WP_003741454.1.69471 WP_003741454.1.69570 WP_003741454.1.69579 WP_003741454.1.69603 WP_003741454.1.69631 WP_003741454.1.69727 WP_003741454.1.6982 WP_003741454.1.69864 WP_003741454.1.6991 WP_003741454.1.69989 WP_003741454.1.70100 WP_003741454.1.70122 WP_003741454.1.7026 WP_003741454.1.70373 WP_003741454.1.7051 WP_003741454.1.70588 WP_003741454.1.70590 WP_003741454.1.70633 WP_003741454.1.70690 WP_003741454.1.70736 WP_003741454.1.70992 WP_003741454.1.71381 WP_003741454.1.71437 WP_003741454.1.71468 WP_003741454.1.71474 WP_003741454.1.71726 WP_003741454.1.7175 WP_003741454.1.71753 WP_003741454.1.71763 WP_003741454.1.71858 WP_003741454.1.71904 WP_003741454.1.72051 WP_003741454.1.72116 WP_003741454.1.7218 WP_003741454.1.72228 WP_003741454.1.72264 WP_003741454.1.72370 WP_003741454.1.72385 WP_003741454.1.72467 WP_003741454.1.72546 WP_003741454.1.72566 WP_003741454.1.72623 WP_003741454.1.72636 WP_003741454.1.72813 WP_003741454.1.72841 WP_003741454.1.72886 WP_003741454.1.72918 WP_003741454.1.73152 WP_003741454.1.73263 WP_003741454.1.734 WP_003741454.1.73448 WP_003741454.1.73508 WP_003741454.1.73545 WP_003741454.1.73613 WP_003741454.1.73656 WP_003741454.1.73769 WP_003741454.1.74095 WP_003741454.1.74148 WP_003741454.1.7421 WP_003741454.1.74217 WP_003741454.1.74436 WP_003741454.1.74450 WP_003741454.1.7454 WP_003741454.1.74572 WP_003741454.1.74617 WP_003741454.1.74728 WP_003741454.1.74754 WP_003741454.1.74823 WP_003741454.1.74927 WP_003741454.1.74956 WP_003741454.1.7504 WP_003741454.1.75072 WP_003741454.1.75196 WP_003741454.1.75216 WP_003741454.1.75240 WP_003741454.1.7528 WP_003741454.1.7553 WP_003741454.1.75541 WP_003741454.1.75548 WP_003741454.1.75624 WP_003741454.1.7565 WP_003741454.1.75670 WP_003741454.1.75838 WP_003741454.1.75869 WP_003741454.1.75923 WP_003741454.1.76094 WP_003741454.1.76168 WP_003741454.1.76247 WP_003741454.1.76254 WP_003741454.1.76367 WP_003741454.1.76545 WP_003741454.1.76608 WP_003741454.1.76926 WP_003741454.1.76982 WP_003741454.1.7718 WP_003741454.1.77191 WP_003741454.1.77222 WP_003741454.1.77261 WP_003741454.1.77345 WP_003741454.1.77350 WP_003741454.1.77376 WP_003741454.1.7738 WP_003741454.1.77389 WP_003741454.1.77420 WP_003741454.1.77594 WP_003741454.1.77675 WP_003741454.1.77681 WP_003741454.1.77697 WP_003741454.1.77823 WP_003741454.1.77928 WP_003741454.1.77943 WP_003741454.1.78088 WP_003741454.1.78130 WP_003741454.1.78167 WP_003741454.1.78315 WP_003741454.1.7832 WP_003741454.1.78328 WP_003741454.1.78336 WP_003741454.1.78681 WP_003741454.1.78717 WP_003741454.1.79128 WP_003741454.1.79149 WP_003741454.1.79212 WP_003741454.1.79259 WP_003741454.1.7932 WP_003741454.1.79351 WP_003741454.1.79434 WP_003741454.1.79458 WP_003741454.1.79602 WP_003741454.1.79630 WP_003741454.1.79821 WP_003741454.1.79964 WP_003741454.1.80028 WP_003741454.1.80036 WP_003741454.1.80088 WP_003741454.1.80105 WP_003741454.1.80514 WP_003741454.1.80693 WP_003741454.1.80968 WP_003741454.1.81140 WP_003741454.1.81261 WP_003741454.1.81270 WP_003741454.1.81315 WP_003741454.1.81476 WP_003741454.1.81495 WP_003741454.1.8151 WP_003741454.1.81647 WP_003741454.1.81662 WP_003741454.1.81713 WP_003741454.1.81863 WP_003741454.1.82274 WP_003741454.1.82294 WP_003741454.1.82372 WP_003741454.1.82440 WP_003741454.1.82480 WP_003741454.1.82605 WP_003741454.1.82662 WP_003741454.1.82667 WP_003741454.1.82821 WP_003741454.1.82893 WP_003741454.1.82951 WP_003741454.1.82974 WP_003741454.1.83015 WP_003741454.1.83030 WP_003741454.1.83121 WP_003741454.1.83130 WP_003741454.1.83137 WP_003741454.1.83215 WP_003741454.1.83217 WP_003741454.1.83260 WP_003741454.1.83350 WP_003741454.1.83478 WP_003741454.1.83542 WP_003741454.1.83546 WP_003741454.1.83755 WP_003741454.1.83809 WP_003741454.1.83877 WP_003741454.1.83907 WP_003741454.1.8391 WP_003741454.1.83932 WP_003741454.1.8418 WP_003741454.1.84180 WP_003741454.1.84265 WP_003741454.1.84320 WP_003741454.1.84367 WP_003741454.1.84539 WP_003741454.1.84579 WP_003741454.1.84588 WP_003741454.1.8460 WP_003741454.1.8465 WP_003741454.1.8473 WP_003741454.1.84781 WP_003741454.1.84833 WP_003741454.1.84895 WP_003741454.1.84974 WP_003741454.1.84980 WP_003741454.1.85036 WP_003741454.1.85037 WP_003741454.1.85172 WP_003741454.1.85194 WP_003741454.1.85203 WP_003741454.1.85321 WP_003741454.1.8539 WP_003741454.1.85576 WP_003741454.1.85690 WP_003741454.1.85887 WP_003741454.1.85890 WP_003741454.1.8593 WP_003741454.1.86056 WP_003741454.1.86091 WP_003741454.1.86098 WP_003741454.1.86232 WP_003741454.1.86253 WP_003741454.1.86279 WP_003741454.1.86308 WP_003741454.1.86484 WP_003741454.1.86571 WP_003741454.1.86597 WP_003741454.1.866 WP_003741454.1.86683 WP_003741454.1.86752 WP_003741454.1.86958 WP_003741454.1.8710 WP_003741454.1.87101 WP_003741454.1.8715 WP_003741454.1.87179 WP_003741454.1.87294 WP_003741454.1.87328 WP_003741454.1.87329 WP_003741454.1.87436 WP_003741454.1.87536 WP_003741454.1.87537 WP_003741454.1.87701 WP_003741454.1.87794 WP_003741454.1.8782 WP_003741454.1.87890 WP_003741454.1.87903 WP_003741454.1.87920 WP_003741454.1.88055 WP_003741454.1.88063 WP_003741454.1.88112 WP_003741454.1.88211 WP_003741454.1.88397 WP_003741454.1.88422 WP_003741454.1.88463 WP_003741454.1.88485 WP_003741454.1.88589 WP_003741454.1.88639 WP_003741454.1.88768 WP_003741454.1.88783 WP_003741454.1.88800 WP_003741454.1.88806 WP_003741454.1.8884 WP_003741454.1.88877 WP_003741454.1.88890 WP_003741454.1.88895 WP_003741454.1.88974 WP_003741454.1.89014 WP_003741454.1.89267 WP_003741454.1.89302 WP_003741454.1.89386 WP_003741454.1.89387 WP_003741454.1.89443 WP_003741454.1.89505 WP_003741454.1.89756 WP_003741454.1.89809 WP_003741454.1.89812 WP_003741454.1.8988 WP_003741454.1.89897 WP_003741454.1.89916 WP_003741454.1.89969 WP_003741454.1.90086 WP_003741454.1.90201 WP_003741454.1.90212 WP_003741454.1.90326 WP_003741454.1.90459 WP_003741454.1.90524 WP_003741454.1.90567 WP_003741454.1.90646 WP_003741454.1.90741 WP_003741454.1.90772 WP_003741454.1.90821 WP_003741454.1.90829 WP_003741454.1.90857 WP_003741454.1.90963 WP_003741454.1.91084 WP_003741454.1.91140 WP_003741454.1.91168 WP_003741454.1.91195 WP_003741454.1.91443 WP_003741454.1.91514 WP_003741454.1.91556 WP_003741454.1.91560 WP_003741454.1.91765 WP_003741454.1.91920 WP_003741454.1.91922 WP_003741454.1.92049 WP_003741454.1.92132 WP_003741454.1.92142 WP_003741454.1.92148 WP_003741454.1.92288 WP_003741454.1.92409 WP_003741454.1.9243 WP_003741454.1.92494 WP_003741454.1.92548 WP_003741454.1.92591 WP_003741454.1.92595 WP_003741454.1.9282 WP_003741454.1.92928 WP_003741454.1.92963 WP_003741454.1.93014 WP_003741454.1.93049 WP_003741454.1.93217 WP_003741454.1.93325 WP_003741454.1.93421 WP_003741454.1.93490 WP_003741454.1.93534 WP_003741454.1.93556 WP_003741454.1.93558 WP_003741454.1.93611 WP_003741454.1.93712 WP_003741454.1.93867 WP_003741454.1.93920 WP_003741454.1.93997 WP_003741454.1.94026 WP_003741454.1.94032 WP_003741454.1.94059 WP_003741454.1.94081 WP_003741454.1.94191 WP_003741454.1.94206 WP_003741454.1.94225 WP_003741454.1.94233 WP_003741454.1.94336 WP_003741454.1.94401 WP_003741454.1.94431 WP_003741454.1.94447 WP_003741454.1.94464 WP_003741454.1.94499 WP_003741454.1.94537 WP_003741454.1.94554 WP_003741454.1.94613 WP_003741454.1.9470 WP_003741454.1.94758 WP_003741454.1.94759 WP_003741454.1.94795 WP_003741454.1.94906 WP_003741454.1.94961 WP_003741454.1.9502 WP_003741454.1.9505 WP_003741454.1.95100 WP_003741454.1.95146 WP_003741454.1.95162 WP_003741454.1.9517 WP_003741454.1.95197 WP_003741454.1.95696 WP_003741454.1.95702 WP_003741454.1.95715 WP_003741454.1.95945 WP_003741454.1.96033 WP_003741454.1.96084 WP_003741454.1.96140 WP_003741454.1.96156 WP_003741454.1.96296 WP_003741454.1.96407 WP_003741454.1.96422 WP_003741454.1.9643 WP_003741454.1.96438 WP_003741454.1.96449 WP_003741454.1.96496 WP_003741454.1.96542 WP_003741454.1.96544 WP_003741454.1.96596 WP_003741454.1.96605 WP_003741454.1.96708 WP_003741454.1.96751 WP_003741454.1.96835 WP_003741454.1.96867 WP_003741454.1.96874 WP_003741454.1.96940 WP_003741454.1.97140 WP_003741454.1.97199 WP_003741454.1.97203 WP_003741454.1.9732 WP_003741454.1.97378 WP_003741454.1.97390 WP_003741454.1.97469 WP_003741454.1.97569 WP_003741454.1.97587 WP_003741454.1.97589 WP_003741454.1.97633 WP_003741454.1.9768 WP_003741454.1.9769 WP_003741454.1.97752 WP_003741454.1.97803 WP_003741454.1.97820 WP_003741454.1.97900 WP_003741454.1.97970 WP_003741454.1.9802 WP_003741454.1.98042 WP_003741454.1.98060 WP_003741454.1.98193 WP_003741454.1.98331 WP_003741454.1.98351 WP_003741454.1.98490 WP_003741454.1.98689 WP_003741454.1.98826 WP_003741454.1.98829 WP_003741454.1.98866 WP_003741454.1.9894 WP_003741454.1.98974 WP_003741454.1.99026 WP_003741454.1.9916 WP_003741454.1.99199 WP_003741454.1.99357 WP_003741454.1.99409 WP_003741454.1.99480 WP_003741454.1.99512 WP_003741454.1.99518 WP_003741454.1.99520 WP_003741454.1.99527 WP_003741454.1.99553 WP_003741454.1.99568 WP_003741454.1.99702 WP_003741454.1.99737 WP_003741454.1.99785 WP_003741454.1.99786 WP_003741454.1.99818 WP_003741454.1.99836 WP_003741454.1.99906 WP_003741454.1.99914 WP_003741454.1.99974 gi|525732920|ref|YP_008288590.1| gi|405757380|ref|YP_006686656.1| gi|405748744|ref|YP_006672210.1| gi|386731147|ref|YP_006204643.1| gi|424713258|ref|YP_007013973.1| gi|404285756|ref|YP_006692342.1| gi|404409633|ref|YP_006695221.1| gi|16802436|ref|NP_463921.1| gi|405754482|ref|YP_006677946.1| gi|470206046|ref|YP_007602621.1| gi|226223016|ref|YP_002757123.1| gi|406703167|ref|YP_006753521.1| gi|404282825|ref|YP_006683722.1| gi|405751605|ref|YP_006675070.1| gi|525721850|ref|YP_008286321.1| gi|550896570|ref|YP_008666066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]