SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 634452.APA01_14730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  634452.APA01_14730
Domain Number 1 Region: 802-1184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-117
Family PFOR PP module 0.0000000272
Further Details:      
 
Domain Number 2 Region: 426-676
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-73
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000734
Further Details:      
 
Domain Number 3 Region: 9-262
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.65e-68
Family PFOR Pyr module 0.0000000535
Further Details:      
 
Domain Number 4 Region: 264-424
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.83e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000118
Further Details:      
 
Domain Number 5 Region: 674-846
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.69e-22
Family Ferredoxin domains from multidomain proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 634452.APA01_14730
Sequence length 1195
Comment (Acetobacter pasteurianus IFO 3283 01)
Sequence
MENVMTEQLQTMDGNTSVAHIAYRVNEVCAIYPITPSSPMAELADTWSDQGVQNIWGEVP
VVQEMQAEGGAAGCVHGALQTGALTTTFTASQGLMLMLPNMFKIAGELTSTVFYVAARAL
AAGASSIFGDHQDIMATRTTGFAMLGAGSVQESHDLALVAQAATLASRIPFIHFADGFRT
SHEYNSLSVVSDDVIRQMIDDRLVHAHRQRALNPEHPFIRGTWQNPDTYFQTREAVNPFY
ERVPAIVQEAMNKFASLTGRQYDLFHYSGAPDAERVVISMGSGSEVVRETAKWLNAQGEK
VGALQVRLFRPFSAEHFLKALPASVKSIAVLDRTKEPGAPMEPLHADVVSVLAEGVGNGQ
FPHMPRVIGGRYGLSSRDFSPAMARAVFDELKKSTPKNHFTVGIIDDVSHTHLEYDETFD
IEPESTVRCLFYGLGADGTVGANKNSVKILSEKPGWYAQAYFDYDSHKSGAETASHLRFG
KSPIEAPYLIRHADFVACHKFDFLFRRDVLGAANNGATFLLNSPYAADKVWEQLPRKVQD
QIVDKKLRFFVIDASDVALKLGLGPRVNTILQTCFFHLSNVLPPDEAISEIKKSIQKTYG
AKGDSVVQLNFRAVDAAVAALHEVAVPAKADGTLPMPPVVPASAPLFVQQVTAEIMAGRG
ESIPVSRIPADGTFPGGTTQYEKRNIAVEVPIWNPDTCIQCGQCSIVCPHSVIRAKTYEE
KDLGGAPESFKSAPVNARGYPDSRFTLQFYVEDCTGCGVCVENCPAINPDGETRAINMGE
KLPILEQERGNIAFFEHLPEVDRAAINEANVRGVQFLEPLFEFSGACAGCGETPYLKLIS
QLFGDRLQIANATGCSAIYAGNTPAHAWKSNAQGRGVAWSNSLFEDNAEFGLGFRLAADK
QESLARQLLQKQADIVGQDLATAIMNAPQMTESEFALQRERVSALRSKLAGINTPDAAML
LSVADFLIRRSIWIVGGDGWAYDIDYGGLDHVLAQGRNVNVIVLDTEVYSNTGGQSSKAT
PLGASAKFAAGGKRVPRKDLALQTIAYGNVYVAQIALGANPEQAIIAMREAEAYEGPSLI
LAYSQCIAHGIDMRTGMKQQARAVASGYWPLFRFDPTMRKSGLNPFRLDSTRPRISLEDY
AYRELRYKTLTRTHPESAAHLLHQAQAAADERYRIYEDMAARDGSRFLPHWEDVN
Download sequence
Identical sequences C7JI09
gi|384050998|ref|YP_005478061.1| gi|384057340|ref|YP_005490007.1| gi|384063273|ref|YP_005483915.1| gi|384054106|ref|YP_005487200.1| gi|384042481|ref|YP_005481225.1| WP_012813055.1.36695 WP_012813055.1.38618 WP_012813055.1.45580 WP_012813055.1.55019 WP_012813055.1.65311 WP_012813055.1.71918 WP_012813055.1.88241 WP_012813055.1.96488 WP_012813055.1.99323 gi|258542560|ref|YP_003187993.1| gi|384119283|ref|YP_005501907.1| gi|384059981|ref|YP_005499109.1| 634452.APA01_14730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]